Description: Participants: Interactions Interaction #1 UNG - TOMM70A Interfaces (1) ELM:TRG_MLS motif (1MGVFCLGPWGLGRKLRTPGKGPLQLLSRLCGDHLQAIPAKKAPA44) in Isoform UNG1 of Uracil-DNA glycosylase (UNG) (2) Tetratricopeptide repeat (114-578) in Mitochondrial import receptor subunit TOM70 (TOMM70A) Interaction Regulation Alternative promoter usage Abrogation of the Isoform UNG1 of Uracil-DNA glycosylase (UNG) TRG_MLS motif - Mitochondrial import receptor subunit TOM70 (TOMM70A) Tetratricopeptide repeat interaction References (1) Identification of sequence determinants of human nuclear dUTPase isoform localization. See also Other switches involving participants |
|