About Help Definitions Submit Search Analyse Browse Home

Switch #:
Switch type:
Switch subtype:

Alternative splicing removes the mitochondrial localisation signal (MLS) motif of tRNA dimethylallyltransferase, mitochondrial (Trit1), abrogating binding to Mitochondrial import receptor subunit TOM70 (TOMM70A). The IPPT-I isoform (also known as Isoform 1 of tRNA dimethylallyltransferase, mitochondrial (Trit1)) was found to localise to both the mitochondria and the cytosol whereas the IPPT-II isoform (also known as Isoform 2 of tRNA dimethylallyltransferase, mitochondrial (Trit1)) is only localised to the cytosol and the nucleus. No nuclear localisation signal (NLS) was identified in either splice variant.

(1) tRNA dimethylallyltransferase, mitochondrial (Trit1)
(2) Mitochondrial import receptor subunit TOM70 (TOMM70A)

Interaction #1 Trit1 - TOMM70A

(1) ELM:TRG_MLS motif (1MAAAAAARAVPVSSGFRGLRRTLPLVVILGATGTGKSTLALQLGQRL47) in tRNA dimethylallyltransferase, mitochondrial (Trit1)
(2) Tetratricopeptide repeat (114-578) in Mitochondrial import receptor subunit TOM70 (TOMM70A)

Interaction Regulation
Alternative splicing Abrogation of the tRNA dimethylallyltransferase, mitochondrial (Trit1) TRG_MLS motif - Mitochondrial import receptor subunit TOM70 (TOMM70A) Tetratricopeptide repeat interaction


(1) Subcellular locations of MOD5 proteins: mapping of sequences sufficient for targeting to mitochondria and demonstration that mitochondrial and nuclear isoforms commingle in the cytosol.
Boguta et al. Mol. Cell. Biol. (1994)

See also

Other switches involving participants
Mitochondrial import receptor subunit TOM70 (TOMM70A) - 7 more (view)

Other switches involving interfaces
ELM:TRG_MLS - 7 more (view)
Tetratricopeptide repeat - 8 more (view)

Loading visualisation

Please send any suggestions/comments to: switches@elm.eu.org