Description: Participants: Interactions Interaction #1 KARS - TOMM70A Interfaces (1) ELM:TRG_MLS motif (1MLTQAAVRLVRGSLRKTSWAEWGHRELRLGQLAPFTAPHKDKSFSDQRS49) in Isoform Mitochondrial of Lysine--tRNA ligase (KARS) (2) Tetratricopeptide repeat (114-578) in Mitochondrial import receptor subunit TOM70 (TOMM70A) Interaction Regulation Alternative splicing Abrogation of the Isoform Mitochondrial of Lysine--tRNA ligase (KARS) TRG_MLS motif - Mitochondrial import receptor subunit TOM70 (TOMM70A) Tetratricopeptide repeat interaction References (1) The human lysyl-tRNA synthetase gene encodes both the cytoplasmic and mitochondrial enzymes by means of an unusual alternative splicing of the primary transcript. See also Other switches involving participants |
|

